научная статья по теме АНТИРЕСТРИКЦИОННАЯ АКТИВНОСТЬ МОНОМЕРНОЙ И ДИМЕРНОЙ ФОРМ БЕЛКА OCR T7 Биология

Текст научной статьи на тему «АНТИРЕСТРИКЦИОННАЯ АКТИВНОСТЬ МОНОМЕРНОЙ И ДИМЕРНОЙ ФОРМ БЕЛКА OCR T7»

МОЛЕКУЛЯРНАЯ БИОЛОГИЯ, 2014, том 48, № 1, с. 176-184

СТРУКТУРНО-ФУНКЦИОНАЛЬНЫЙ АНАЛИЗ БИОПОЛИМЕРОВ И ИХ КОМПОНЕНТОВ

УДК 571.21.579.23

АНТИРЕСТРИКЦИОННАЯ АКТИВНОСТЬ МОНОМЕРНОЙ И ДИМЕРНОЙ ФОРМ БЕЛКА Ocr T7

© 2014 г. Г. Б. Завильгельский*, В. Ю. Котова

Государственный научный центр"ГосНИИгенетика", Москва, 117545 Поступила в редакцию 25.06.2013 г. Принята к печати 01.07.2013 г.

Антирестрикционный белок Ocr, кодируемый геном 0.3(ocr) бактериофага Т7, специфически ингибиру-ет ферменты рестрикции-модификации типа I. Белок Ocr входит в семейство ДНК-мимикрирующих белков. Как в растворе, так и в кристаллическом состоянии нативный Ocr формирует гомодимер. Сконструированы мутантные формы белка Ocr, которые содержат замены двух аминокислотных остатков (Ocr F53D A57E и Ocr F53R V77D) и образуют в растворе мономеры. Показано, что константа диссоциации (А^), характеризующая комплекс белка с ферментом EcoKI (R2M2S), у гомодимера (Ocr)2 и мономеров Ocr F53D A57E и Ocr F53R V77D различается в 1000 раз: Kd (Ocr) = 10-10 M, Kd (Ocr F53D A57E и Ocr F53R V77D) = 10-7 M. Антимодификационная активность мономерных форм Ocr значительно снижена. Показано, что для проявления высокой ингибиторной активности принципиальное значение имеет димерная форма белка Ocr.

Ключевые слова: ферменты рестрикции-модификации типа I, антирестрикционные белки, фаг T7, Ocr.

ANTIRESTRICTION ACTIVITY OF T7 OCR PROTEIN IN MONOMERIC AND DIMERIC FORMS, by G. B. Zavilgelsky*, V. Yu. Kotova (State Research Center "GosNIIgenetika", 117545 Moscow, Russia; *e-mail: zavilgel@genetika.ru). The Ocr protein, encoded by 0.3(ocr) gene of bacteriophage T7, belongs to the family of antirestriction proteins that specifically inhibit the type I restriction-modification systems. Native Ocr forms ho-modimer (Ocr)2 both in solution and in the crystalline state. The Ocr protein belongs to the family of mimicry proteins. F53D A57E and E53R V77D mutant proteins were obtained, which form monomers. It was shown that the values of the dissociation constants Kd for Ocr, Ocr F53D A57E and Ocr F53R V77D proteins with EcoKI enzyme differ in 1000 times: Kd (Ocr) = 10-10 M, Kd (Ocr F53D A57E and Ocr F53R V77D) = 10-7 M. Antimodification activity of the Ocr monomeric forms is significantly reduced. We have shown, that Ocr dimeric form has fundamental importance for high inhibitory activity.

Keywords: restriction-modification system type I, antirestriction protein, phage Т7, Ocr. DOI: 10.7868/S0026898413060189

Антирестрикционный белок Ocr, кодируемый геном 0.3(ocr) бактериофага T7, специфически ингибирует ферменты рестрикции-модификации типа I [1, 2]. Очень кислый (pI = 3.8) белок Ocr (13.6 кДа, 116 аминокислотных остатков) несет суммарный высокий отрицательный заряд (—28) и принадлежит к семейству ДНК-мимикрирую-щих белков [3—5]. Нативный Ocr образует гомодимер (Ocr)2, формирующий длинную бананоподоб-ную структуру, по поверхности которой распределены отрицательные заряды (карбоксильные группы Asp и Glu), имитирующие расположение отрицательно заряженных фосфатных групп в двойной спирали В-формы ДНК [5]. Основу "стержня" мономера Ocr составляют три а-спира-ли: A (остатки 7—24), B (остатки 34—44) и длин-

* Эл. почта: zavilgel@genetika.ru

ная, несколько изогнутая D (остатки 73—106). Эти спирали формируют плотно упакованный пучок со строгим распределением отрицательно заряженных карбоксильных групп Asp и Glu вдоль оси "стержня", соответствующим распределению отрицательно заряженных фосфатных групп вдоль двойной спирали ДНК. Структура димера (Ocr)2 как в растворе, так и в кристаллическом состоянии и по длине, и по распределению отрицательных зарядов соответствует фрагменту двойной спирали ДНК размером 24 п.н. Короткая а-спираль C (аминокислотные остатки 49—57) расположена примерно в середине полипептида (интерфейс) и определяет контакт мономеров в димере, устанавливаемый в основном за счет ван-дер-ваальсовых взаимодействий между гидрофобными кластерами

из семи аминокислот IFSVMAS, начиная с I52, и V77 [5].

Белок Ocr подавляет активность ферментов рестрикции-модификации типа I посредством конкурентного ингибирования: за счет сходства структур антирестрикционного белка с ДНК происходит вытеснение нити ДНК из комплекса с ферментом. Высокая эффективность ингибирования определяется значительно большей величиной константы связывания (Ocr)2 с ферментом, чем с дцДНК. Например, Kd (Ocr)2 = 10-10 M, что примерно в 50 раз ниже значения Kd для ДНК [6, 7]. Возникает вопрос, какая особенность структуры Ocr — высокий отрицательный заряд, распределенный по поверхности макромолекулы, или же бананоподобная форма белка — создают основу для его высокой активности как ингибитора. Необходимо отметить, что ДНК-подобная структура димера Ocr в области контакта мономеров формирует "изгиб" (bend), в результате продольные оси мономеров образуют в точке контакта угол около 45° [5], что совпадает по величине с "изгибом", формирующимся в дцДНК при взаимодействии с ферментом рестрикции-модификации типа I [8]. Предполагается, что наличие "изгиба" в середине молекулы Ocr определяет преимущество этого белка перед ДНК при взаимодействии с ферментами рестрикции-модификации, так как в этом случае отсутствуют значительные энергетические затраты, необходимые для формирования "изгиба".

Изучена роль отрицательного заряда на поверхности (Ocr)2 в процессе эффективного инги-бирования ферментов рестрикции-модификации типа I [9—11]. Показано, что снижение отрицательного заряда на поверхности белка Ocr слабо влиет на его антирестрикционную активность. Лишь при уменьшении числа отрицательных зарядов более чем на 50%, достигнутого как с помощью мутационных замен отрицательно заряженных аминокислотных остатков нейтральными, так и с помощью химической модификации карбоксильных групп, снижается константа связывания белка (Ocr)2 с ферментом.

В настоящей работе мы изучали роль димерной и мономерной форм антирестрикционного белка Ocr в процессах ингибирования эндонуклеазной (рестрикционной) и метилазной (модификацион-ной) активностей фермента EcoKI. С этой целью использовали мутантные белки Ocr, содержащие точечные аминокислотные замены в области интерфейса, определяющего контакт мономеров в димере (Ocr)2, и не способные формировать форму димера, но при этом практически полностью сохранившие картину распределения отрицательного заряда на поверхности полипептида.

ЭКСПЕРИМЕНТАЛЬНАЯ ЧАСТЬ

Бактериальные штаммы, бактериофаги и плаз-

миды. В работе использовали следующие штаммы Escherichia coli K-12: JM109 recA1 endA1 gyrA96 thi supE44 relA1 hsdR17 A(lac-proAB) [F'traD36 proAB lacIqZ AM15]; TG-1 thi relA supE44 hsdR17 hsdM A(lac-proAB) [F'(traD36 proAB+ lacIq lacZ AM15]; AB1157 F- thr-1, leu-6, proA2, his-4, thi-1, argE3, lacY1, galK2, ara14, xyl-5, mtl-1, tsx-33, rpsL31, supE44; AB2463 recA13 (остальные маркеры, как у AB1157). Штамм AB2463 (DE3) любезно предоставлен А.А. Белогуровым (Москва).

Использовали также штаммы E. coli K12 AB1157 tetR и MG1655 Z1 tetR, которые содержат в составе хромосомы ген, кодирующий TetR, бе-лок-репрессор промотора PtetA. Оба штамма получены трансдукцией с помощью фага P1 согласно ]12]. В качестве донора использовали E. coli DH5aZ1 tetR, в геноме которого ген tetR тесно (90% котрансдукции) сцеплен с геном, определяющим устойчивость бактерии к спектиномицину.

Бактериофаг Х^г (обозначен ниже как X) получен от проф. R. Devoret (Франция). Немодифици-рованные фаги, выросшие на штамме E .coli TG-1, у которого отсутствует система рестрикции-модификации типа I, обозначены как X.0, а модифицированные фаги, выросшие на штамме AB1157 rk+ + mk+, как X.k.

В работе использовали векторы pTZ57R, pET-15b ("Novagen"), pUC18. В качестве векторов, содержащих строго регулируемый промотор, использовали векторы серии pZ с репликонами ColEl (pZE21 Knr) и pSC101 (pZS33 Cmr), копий-ность которых составляет 60—70 и 8—10 копий на клетку соответственно [13]. В качестве строго регулируемой промоторной-операторной области в векторы встраивали фрагмент ДНК, содержащий PltetO-1. Промотор PltetO-1 состоит из промоторной части Pl из генома фага X и из операторной части tetO2 из регуляторной области оперона тетрациклин-устойчивости транспозона Tn10. Векторы pZE21 Knr и pZS33 Cmr содержат также последовательность Шайна—Дальгарно (RBS) и полилинкер, служащий для встраивания фрагмента ДНК с исследуемым геном.

Использовали сконструированные нами ранее гибридные плазмиды pZS33-lux и pZE21-lux, содержащие гены luxCDABE Photorhabdus luminescens под промотором PltetO-1, [14].

Плазмида pMocr (вектор pMCSG7 (5286 bp) Apr со встроенным геном мономерного белка Mocr), любезно предоставлена проф. William C. Brown (США). В последовательности нуклеотидов гена, кодирующего белок Mocr, кодон 53 (TTT) заменен кодоном CGT а кодон 77 GTA заменен на GAC. В результате получили белок, в котором заменены два аминокислотных остатка — А53R и V77D [15].

Среды, ферменты, реактивы. Состав сред и концентрации добавок приведены в работе [14]. В опытах с клонированием использовали L-бульон и L-агар. В реакциях расщепления и лиги-рования использовали ферменты фирмы "Fermentas" (Литва).

Конструирование плазмид. Ген moer, входящий в состав плазмиды pMocr (вектор pMCSG7 с встроенным геном moer), определяет синтез белка Mocr, размер которого значительно больше чем у Ocr T7 (140 аминокислотных остатков вместо 116), так как помимо основной последовательности Ocr он содержит His6-tag, Tev-сайт, а также группу аминокислотных остатков, соединяющих фрагменты с последовательностью белка Ocr: MHHHHHHSSGVDLAMSNMTYNNVFDHAYEM-LKENIRYDDIRDTDDLHDAIHMAADNAVPHYYAD-IRSVMASEGIDLEFEDSGLMPDTKDDIRILQARJYE-QLTIDLWEDAEDLLNEYEEEVEEYEEDEEGTEN-LYFQSNA (курсивом выделены аминокислотные остатки белка Ocr) [15]. Поэтому был переклонирован ген moer (не кодирующий His6-tag и Tev-сайт), содержащий только кодоны для синтеза белка Ocr. Переклонирование проводили с использованием Т-вектора pTZ57R, а также векторов pUC18 и pZE21 tetR. При первичном переклонировании в Т-вектор использовали следующие праймеры:

Для дальнейшего прочтения статьи необходимо приобрести полный текст. Статьи высылаются в формате PDF на указанную при оплате почту. Время доставки составляет менее 10 минут. Стоимость одной статьи — 150 рублей.

Показать целиком

Пoхожие научные работыпо теме «Биология»