научная статья по теме TNF-СВЯЗЫВАЮЩИЙ ДОМЕН БЕЛКА CRMB ВИРУСА НАТУРАЛЬНОЙ ОСПЫ, СИНТЕЗИРОВАННЫЙ В КЛЕТКАХ ESCHERICHIA COLI, ЭФФЕКТИВНО ВЗАИМОДЕЙСТВУЕТ С TNF ЧЕЛОВЕКА Математика

Текст научной статьи на тему «TNF-СВЯЗЫВАЮЩИЙ ДОМЕН БЕЛКА CRMB ВИРУСА НАТУРАЛЬНОЙ ОСПЫ, СИНТЕЗИРОВАННЫЙ В КЛЕТКАХ ESCHERICHIA COLI, ЭФФЕКТИВНО ВЗАИМОДЕЙСТВУЕТ С TNF ЧЕЛОВЕКА»

ДОКЛАДЫ АКАДЕМИИ НАУК, 2015, том 462, № 4, с. 488-492

БИОХИМИЯ, БИОФИЗИКА, МОЛЕКУЛЯРНАЯ БИОЛОГИЯ

УДК 578.821

TNF-СВЯЗЫВАЮЩИИ ДОМЕН БЕЛКА CrmB ВИРУСА НАТУРАЛЬНОЙ ОСПЫ, СИНТЕЗИРОВАННЫЙ В КЛЕТКАХ Escherichia coli, ЭФФЕКТИВНО ВЗАИМОДЕЙСТВУЕТ С TNF ЧЕЛОВЕКА

© 2015 г. Т. В. Трегубчак, С. В. Шеховцов, Т. С. Непомнящих, С. Е. Пельтек, академик РАН Н. А. Колчанов, С. Н. Щелкунов

Поступило 29.01.2015 г.

DOI: 10.7868/S0869565215160276

Центральная роль фактора некроза опухолей (TNF) в инициации и/или поддержании воспалительных процессов при ревматоидном артрите (РА), болезни Крона и других хронических воспалительных заболеваниях была многократно установлена в экспериментальных системах in vitro и in situ. Это нашло четкое подтверждение также при успешном лечении данных патологий в результате направленной анти-TNF терапии [1].

Взаимодействие TNF с его клеточными рецепторами потенциально можно ингибировать с помощью моноклональных анти-TNF антител или растворимых форм клеточных TNF-рецепторов типа I (TNFRI) или II (TNFRII). Данный подход к лечению хронических воспалительных заболеваний получил название биологической терапии и оказался наиболее эффективным среди существующих методов лечения. В настоящее время разработан ряд TNF-антагонистов, первые три из которых — инфликсимаб (Infliximab/Remicade), адалимумаб (Adalimumab/Himura) и этанерцепт (Etanercept/Enbrel) — активно применяются в клинике для терапии воспалительных заболеваний. Инфликсимаб — химерное моноклональное антитело к TNF, содержащее человеческую константную часть и мышиный вариабельный район IgG. Оно взаимодействует со свободным и мем-брансвязанным TNF с высокой аффинностью. Адалимумаб — полностью человеческое моноклональное антитело к TNF, также связывающее свободный и мембранассоциированный лиганд. Этанерцепт представляет собой рекомбинантный

Государственный научный центр вирусологии

и биотехнологии "Вектор",

п. Кольцово Новосибирской обл.

E-mail: snshchel@vector.nsc.ru; snshchel@rambler.ru

Институт цитологии и генетики

Сибирского отделения Российской Академии наук,

Новосибирск

химерный белок, состоящий из двух цистеинбо-гатых доменов (CRD) рецептора TNFRII человека, соединенных с Fc-фрагментом IgG1 человека [2].

Хотя известные в настоящее время биологические ингибиторы TNF продемонстрировали относительно высокую (по сравнению с препаратами другого типа) эффективность в процессе контролируемых исследований терапии РА, в реальной клинической практике около 30—40% пациентов невосприимчивы к терапии теми или иными препаратами данного типа. Менее чем у половины больных удается достигнуть полной или частичной ремиссии, а около 1/3 вынуждены прекращать лечение из-за развития вторичной неэффективности или побочных эффектов [3]. В частности, это может быть обусловлено развитием иммунного ответа на многократно вводимый белковый препарат (указанные выше TNF-антаго-нисты имеют размер 148—150 кДа) [4]. Поэтому при длительной терапии РА и других воспалительных заболеваний может возникать необходимость замены применяемого биологического ан-ти-TNF препарата на другой. Используемые в настоящее время в клинике белковые анти-TNF препараты дороги, что также ограничивает их применение [5]. Все это указывает на необходимость расширения спектра TNF-антагонистов.

В качестве TNF-антагониста нового поколения в последние годы мы исследуем белок CrmB вируса натуральной оспы (VARV-CrmB). Реком-бинантный полноразмерный VARV-CrmB синтезировали в эукариотической бакуловирусной системе и на разных лабораторных моделях in vitro и in vivo показали его высокую эффективность в качестве TNF-антагониста [3, 6]. Оказалось, что вирусный TNF-связывающий белок VARV-CrmB является двухдоменным и наряду с TNF связывает ряд хемокинов [7].

Поэтому задачами настоящего исследования были получение бактериального продуцента уко-

TNF-СВЯЗЫВАЮЩИЙ ДОМЕН БЕЛКА

489

-Сигнальный пептид--CRD1-^

1 MKSVLYLYILFLSCI11NGRDAAPYTРPNGKCKDТЕYKRHNLCCLSСРPGTYASRLCD SKTNTQCТР

-CRD2--CRD3-

68 CGSGTFTSRNNHLPACLSCNGRCNSNQVETRSCNTTHNRICECSPGYYCLLKGSSGCKACVSQTKCG

135 IGYGVSGHTSVGDVICSPCGFGTYSHTVSSADKCEPVPNNTFNYIDVEITLYPVNDTSCTRTTTTGL

SECRET-домен

202 SESILTSELTITMNHTDCNPVFREEYFSVLNKVATSGFFTGENRYQNISKVCTLNFEIKCNNKGSSF

269 KQLTKAKNDDGMMSHSETVTLAGDCLSSVDIYILYSNTNAQDYETDTISYRVGNVLDDDSHMPGSCN

336 IHKPITNSKPTRFL 349

Рис. 1. Аминокислотная последовательность белка VARV-CrmB (штамм India-1967). CRD1—CRD3 — цистеинбогатые субдомены TNF-связывающего домена [8]; SECRET — хемокинсвязывающий домен [9]. Нижним подчеркиванием выделена аминокислотная последовательность, соответствующая полученному в работе белку TNF-BD.

роченного варианта белка VARV-CrmB, состоящего только из ^-концевого TNF-связывающего домена (TNF-BD); сравнительное изучение белка VARV-CrmB, синтезированного в эукариотиче-ской бакуловирусной системе, и укороченного TNF-BD, синтезированного в клетках E. coli, по эффективности их взаимодействия с TNF человека и иммуногенным свойствам при их многократном введении в организм лабораторных животных.

Фрагмент ДНК, содержащий кодирующую последовательность TNF-BD, получали в результате проведения ПЦР. В реакции в качестве матрицы использовали ДНК рекомбинантного бакуловируса, содержащего ген полноразмерного белка СгшВ вируса натуральной оспы (ЛАКУ, штамм Индия-1967) [6]. Олигонуклеотидные праймеры для амплификации необходимого фрагмента ДНК имели следующую структуру:

5'-CGCCATGGCACCGTATACACCACCCAATGGA-3' 5'-CGAGATCTGGGTACGGGTTCGCATTTATCTG-3'

В составе этих праймеров заложены сайты узнавания эндонуклеаз рестрикции NсоI и (выделены в последовательностях полужирным курсивом). Олигонуклеотидные праймеры были рассчитаны с помощью программы "О%о" (версия 3.3) так, чтобы удалить сигнальный пептид,

присутствующий на Оконце целевого белка УАЯУ-СгшВ (рис. 1).

Амплифицированный фрагмент ДНК, кодирующий белок TNF-BD, встроили в открытую рамку трансляции векторной плазмиды pQE-60 ("Qiagen", Германия) по сайтам эндонуклеаз ре-

стрикции NcoI-BglII таким образом, чтобы в процессе трансляции на С-конце целевого белка синтезировались дополнительные 6 гистидиновых остатков. Анализ выделенной рекомбинантной плазмиды pQE-60-TNFR-CrmB-Ind-67 на наличие в ее структуре клонируемого фрагмента ДНК осуществляли гидролизом эндонуклеазами рестрикции NcoI и BglII, последовательность нук-леотидов клонированного фрагмента ДНК подтверждали секвенированием.

Продукцию TNF-BD изучали в штаммах E. coli XL2blue, SG13009[pRep4] и M15[pRep4], трансформированных рекомбинантной плазмидой pQE-60-TNFR-CrmB-Ind-67. Наивысший уровень экспрессии целевого гена был выявлен при использовании штамма E. coli SG13009[pRep4], поэтому дальнейшую работу проводили с этим штаммом. Суспензию клеток E. coli SG13009[pRep4], трансформированных рекомбинантной плазмидой pQE-60-TNFR-CrmB-Ind-67, инкубировали при эффективной аэрации и температуре 37°C до оптической плотности (OD550) 0.6, после чего индуцировали продукцию белка добавлением изопро-пил^^-1-тиогалактопиранозида (ИПТГ) до концентрации 1 мМ. Результаты экспериментов показали, что наибольший выход белка наблюдается на 4-5-м часе после добавления ИПТГ (данные не представлены).

Поскольку белок TNF-BD в процессе синтеза в клетках E. coli формирует тельца включения, очистку белкового продукта из биомассы штамма-продуцента осуществляли в денатурирующих условиях на колонке с агарозой Ni-NTI ("Qiagen") согласно протоколу фирмы-изготовителя. Белковые пробы после элюции очищали от солей посредством диализа против фосфатно-со-левого буфера (PBS).

Белок VARV-CrmB выделяли методом аффинной хроматографии из культуральной среды клеток хлопковой совки Spodoptera frugiperda Sf-21, зараженных рекомбинантным бакуловирусом, как описано [10].

Идентификацию целевых рекомбинантных белков в изучаемых препаратах проводили с помощью Вестерн-блот-анализа. Положительную реакцию по связыванию с поликлональными антителами к белку VARV-CrmB зарегистрировали как у VARV-CrmB, так и у укороченного белка TNF-BD, синтезированного в клетках E. coli.

Электрофоретический анализ показал, что полноразмерный белок VARV-CrmB, синтезированный в клетках насекомых, имеет электрофо-ретическую подвижность 47 кДа, а продуцируемый в бактериальных клетках TNF-BP — 17 кДа. Следует отметить, что синтезированный в клетках E. coli TNF-BD не гликозилирован, в то время как произведенный в клетках насекомых VARV-CrmB гликозилирован [11].

Для того чтобы определить способность белков VARV-CrmB и TNF-BD предотвращать взаимодействие hTNF с его специфическими рецепторами эукариотических клеток, исследовали их способность нейтрализовать цитотоксическое действие hTNF на культуре клеток L929 [6]. Концентрацию белков VARV-CrmB и TNF-BD определяли по методу Бредфорда [12]. Культуральные работы проводили в пластиковых 96-луночных планшетах ("Costar", США) при использовании среды DMEM ("Gibco", США) и эмбриональной сыворотки телят ("БиолоТ", Россия). Результаты этих экспериментов показали, что как VARV-CrmB, так и TNF-BD нейтрализуют цитотоксиче-ское действие hTNF in vitro дозозависимым образом.

Количественную оценку эффективности взаимодействия белков VARV-CrmB и TNF-BD с hTNF ("Gibco") осуществляли методом поверхностного плазмонного резонанса на оптическом биосенсоре ProteOn_XPR36 Protein Interaction Array System ("Bio-Rad Laboratories, Inc.", США). На поверхность чипа ковалентно иммобилизовали рекомбинантные белки VARV-CrmB или TNF-BD. Эффективность взаимодействия целевых ре-комбинантных белков с hTNF оценивали при использовании данного цитокина в пяти различных концентрациях от 6.25 до 100 нМ. Результаты выполненных анализов приведены на рис. 2. Оценка аффинности взаимодействия рекомбинантных вирусных рецепторов с hTNF показала, что KD для комплекса VARV-CrmB/hTNF составляет 2.48 х х 10-9, а для пары TNF-BD/hTNF - 5.26 х 10-10 M. Показатели стабильности этих комплексов (Kd) составили 7.59 х 10-4 и 1.18 х 10-4 с-1 соответственно. Как видим, укороченный TNF-BD с большей эффективностью по сравнению с полноразмерным белком CrmB связывается с hTNF.

Важно было провес

Для дальнейшего прочтения статьи необходимо приобрести полный текст. Статьи высылаются в формате PDF на указанную при оплате почту. Время доставки составляет менее 10 минут. Стоимость одной статьи — 150 рублей.

Показать целиком

Пoхожие научные работыпо теме «Математика»